Find multiple substrings in strings and record location
Following is the script for finding consecutive substrings in strings.
use strict;
use warnings;
my $file="Sample.txt";
open(DAT, $file) || die("Could not open file!");
#worry about these later
#my $regexp1 = "motif1";
#my $regexp2 = "motif2";
#my $regexp3 = "motif3";
#my $regexp4 = "motif4";
my $sequence;
while (my $line = <DAT>) {
if ($line=~ /(HDWFLSFKD)/g){
{
print "its found index location: ",
pos($line), "-", pos($line)+length($1), "\n";
}
if ($line=~ /(HD)/g){
print "motif found and its locations is: \n";
pos($line), "-", pos($line)+length($1), "\n\n";
}
if ($line=~ /(K)/g){
print "motif found and its location is: \n";
pos($line), "-",pos($line)+length($1), "\n\n";
}
if ($line=~ /(DD)/g){
print "motif found and its location is: \n";
pos($line), "-", pos($line)+length($1), "\n\n";
}
}else {
$sequence .= $line;
print "came in else\n";
}
}
It matches substring1 to a string and prints the position where substring 1 matches. The problem is finding the rest of the substrings. For substrings2, it starts again from the beginning of the string (instead of starting from the position where substring1 was found). The problem is that every time it calculates a position, it starts from the beginning of the string, rather than starting from the position of the previously found substring. Since substrings are consecutive substring1, substring2, substring3, substring4, their positions must be after the previous one, respectively.
a source to share
I'm not a perl expert, but you can use $ - and $ + to track the location of the index for the last regex match.
Below is some code built on top of your code that explains this.
use strict;
use warnings;
my $file="sample.txt";
open(DAT, $file) || die("Could not open file!");
open (OUTPUTFILE, '>data.txt');
my $sequence;
my $someVar = 0;
my $sequenceNums = 1;
my $motif1 = "(HDWFLSFKD)";
my $motif2 = "(HD)";
my $motif3 = "(K)";
my $motif4 = "(DD)";
while (my $line = <DAT>)
{
$someVar = 0;
print "\nSequence $sequenceNums: $line\n";
print OUTPUTFILE "\nSequence $sequenceNums: $line\n";
if ($line=~ /$motif1/g)
{
&printStuff($sequenceNums, "motif1", $motif1, "$-[0]-$+[0]");
$someVar = 1;
}
if ($line=~ /$motif2/g and $someVar == 1)
{
&printStuff($sequenceNums, "motif2", $motif2, "$-[0]-$+[0]");
$someVar = 2;
}
if ($line=~ /$motif3/g and $someVar == 2)
{
&printStuff($sequenceNums, "motif3", $motif4, "$-[0]-$+[0]");
$someVar = 3;
}
if ($line=~ /$motif4/g and $someVar == 3)
{
&printStuff($sequenceNums, "motif4", $motif4, "$-[0]-$+[0]");
}
else
{
$sequence .= $line;
if ($someVar == 0)
{
&printWrongStuff($sequenceNums, "motif1", $motif1);
}
elsif ($someVar == 1)
{
&printWrongStuff($sequenceNums, "motif2", $motif2);
}
elsif ($someVar == 2)
{
&printWrongStuff($sequenceNums, "motif3", $motif3);
}
elsif ($someVar == 3)
{
&printWrongStuff($sequenceNums, "motif4", $motif4);
}
}
$sequenceNums++;
}
sub printStuff
{
print "Sequence: $_[0] $_[1]: $_[2] index location: $_[3] \n";
print OUTPUTFILE "Sequence: $_[0] $_[1]: $_[2] index location: $_[3]\n";
}
sub printWrongStuff
{
print "Sequence: $_[0] $_[1]: $_[2] was not found\n";
print OUTPUTFILE "Sequence: $_[0] $_[1]: $_[2] was not found\n";
}
close (OUTPUTFILE);
close (DAT);
Input example:
MLTSHQKKFHDWFLSFKDSNNYNHDSKQNHSIKDDIFNRFNHYIYNDLGIRTIA MLTSHQKKFSNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA MLTSHQKKFSNNNYNSKHDWFLSHDFKDQND
a source to share
Try this perl program
use strict;
use warnings;
use feature qw'say';
my $file="Sample.txt";
open( my $dat, '<', $file) || die("Could not open file!");
my @regex = qw(
HDWFLSFKD
HD
K
DD
);
my $sequence;
while( my $line = <$dat> ){
chomp $line;
say 'Line: ', $.;
# reset the position of variable $line
# pos is an lvalue subroutine
pos $line = 0;
for my $regex ( @regex ){
$regex = quotemeta $regex;
if( scalar $line =~ / \G (.*?) ($regex) /xg ){
say $regex, ' found at location (', $-[2], '-', $+[2], ')';
if( $1 ){
say " but skipped: \"$1\" at location ($-[1]-$+[1])";
}
}else{
say 'Unable to find ', $regex;
# end loop
last;
}
}
}
a source to share
You should really read
You need the special variables @ - and @ + if you want positions. You don't have to try to figure them out yourself.
#!/usr/bin/perl
use strict;
use warnings;
use List::MoreUtils qw( each_array );
my $source = 'AAAA BBCCC DD E FFFFF';
my $pattern = join '\s*', map { "($_+)" } qw( A B C D E F );
if ( $source =~ /$pattern/ ) {
my $it = each_array @-, @+;
$it->(); # discard overall match information;
while ( my ($start, $end) = $it->() ) {
printf "Start: %d - Length: %d\n", $start, $end - $start;
}
}
Start: 0 - Length: 4
Start: 7 - Length: 2
Start: 9 - Length: 3
Start: 15 - Length: 2
Start: 19 - Length: 1
Start: 26 - Length: 5
a source to share
To match with the last match, use \G
. perldoc perlre says (but consult your own version first for installation):
The "\ G" assertion can be used for (using "m // g"), as described in "Regexp Quote-Like Operators" in perlop. useful when writing "lex" -like scanners when you have multiple patterns that you want to match against subsequent substrings of your strings, see the previous link. The actual location where "\ G" will be in the match can also be affected by using "pos ()" as an lvalue: see "pos" in perlfunc. Note that the rule for the changed zero length match is somewhat, in this content the left of the "\ G" is not taken into account when determining the length of the match. So the following will not match forever:
$str = 'ABC'; pos($str) = 1; while (/.\G/g) { print $&; }
a source to share